BRCC3,BRCC36,C6.1A
  • BRCC3,BRCC36,C6.1A

Anti-BRCC3 Antibody 25ul

Ref: AN-HPA048737-25ul
Anti-BRCC3

Información del producto

Polyclonal Antibody against Human BRCC3, Gene description: BRCA1/BRCA2-containing complex, subunit 3, Alternative Gene Names: BRCC36, C6.1A, CXorf53, Validated applications: ICC, Uniprot ID: P46736, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BRCC3
Gene Description BRCA1/BRCA2-containing complex, subunit 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSEYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLE
Immunogen PSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSEYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BRCC36, C6.1A, CXorf53
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P46736
HTS Code 3002150000
Gene ID 79184
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BRCC3 Antibody 25ul

Anti-BRCC3 Antibody 25ul