HDAC4,BDMR,HA6116
  • HDAC4,BDMR,HA6116

Anti-HDAC4 Antibody 100ul

Ref: AN-HPA048723-100ul
Anti-HDAC4

Información del producto

Polyclonal Antibody against Human HDAC4, Gene description: histone deacetylase 4, Alternative Gene Names: BDMR, HA6116, HD4, HDAC-4, HDAC-A, HDACA, KIAA0288, Validated applications: ICC, Uniprot ID: P56524, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HDAC4
Gene Description histone deacetylase 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKL
Immunogen QDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BDMR, HA6116, HD4, HDAC-4, HDAC-A, HDACA, KIAA0288
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P56524
HTS Code 3002150000
Gene ID 9759
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HDAC4 Antibody 100ul

Anti-HDAC4 Antibody 100ul