R3HDM4,C19orf22
  • R3HDM4,C19orf22

Anti-R3HDM4 Antibody 25ul

Ref: AN-HPA048638-25ul
Anti-R3HDM4

Información del producto

Polyclonal Antibody against Human R3HDM4, Gene description: R3H domain containing 4, Alternative Gene Names: C19orf22, MGC16353, Validated applications: IHC, Uniprot ID: Q96D70, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name R3HDM4
Gene Description R3H domain containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RLLRFFSVSPQAVYTAMLDNSFERLLLHAVCQYMDLISASADLEGKRQMKVSNRHLDFLPPGLLLSAYLEQHS
Immunogen RLLRFFSVSPQAVYTAMLDNSFERLLLHAVCQYMDLISASADLEGKRQMKVSNRHLDFLPPGLLLSAYLEQHS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C19orf22, MGC16353
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96D70
HTS Code 3002150000
Gene ID 91300
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-R3HDM4 Antibody 25ul

Anti-R3HDM4 Antibody 25ul