ASAP1,CENTB4,DDEF1
  • ASAP1,CENTB4,DDEF1

Anti-ASAP1 Antibody 25ul

Ref: AN-HPA048565-25ul
Anti-ASAP1

Información del producto

Polyclonal Antibody against Human ASAP1, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 1, Alternative Gene Names: CENTB4, DDEF1, KIAA1249, PAP, ZG14P, Validated applications: ICC, IHC, Uniprot ID: Q9ULH1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ASAP1
Gene Description ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDC
Immunogen PKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CENTB4, DDEF1, KIAA1249, PAP, ZG14P
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9ULH1
HTS Code 3002150000
Gene ID 50807
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ASAP1 Antibody 25ul

Anti-ASAP1 Antibody 25ul