View larger
Anti-TMEM55B Antibody 25ul
AN-HPA048528-25ul
New product
Anti-TMEM55B
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 25ul |
| Gene Name | TMEM55B |
| Gene Description | transmembrane protein 55B |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | WB, IHC |
| Sequence | GHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQS |
| Immunogen | GHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQS |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | C14orf9, MGC26684 |
| Category | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | Q86T03 |
| HTS Code | 3002150000 |
| Gene ID | 90809 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicativo | IHC, WB |
| Conjugation | Unconjugated |
More info
Polyclonal Antibody against Human TMEM55B, Gene description: transmembrane protein 55B, Alternative Gene Names: C14orf9, MGC26684, Validated applications: IHC, WB, Uniprot ID: Q86T03, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF