TMEM255A,FAM70A
  • TMEM255A,FAM70A

Anti-TMEM255A Antibody 100ul

Ref: AN-HPA048470-100ul
Anti-TMEM255A

Información del producto

Polyclonal Antibody against Human TMEM255A, Gene description: transmembrane protein 255A, Alternative Gene Names: FAM70A, FLJ20716, Validated applications: IHC, WB, Uniprot ID: Q5JRV8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMEM255A
Gene Description transmembrane protein 255A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence FKDMNPTLPALNCSVENTHPTVSYYAHPQVASYNTYYHSPPHLPPYSAYDFQHSGVFPSSPPSGLSDEPQSASPSPSYMWSSSAPPRYSPPY
Immunogen FKDMNPTLPALNCSVENTHPTVSYYAHPQVASYNTYYHSPPHLPPYSAYDFQHSGVFPSSPPSGLSDEPQSASPSPSYMWSSSAPPRYSPPY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM70A, FLJ20716
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5JRV8
HTS Code 3002150000
Gene ID 55026
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TMEM255A Antibody 100ul

Anti-TMEM255A Antibody 100ul