FAM43A,FLJ90022
  • FAM43A,FLJ90022

Anti-FAM43A Antibody 100ul

Ref: AN-HPA048345-100ul
Anti-FAM43A

Información del producto

Polyclonal Antibody against Human FAM43A, Gene description: family with sequence similarity 43, member A, Alternative Gene Names: FLJ90022, Validated applications: ICC, IHC, Uniprot ID: Q8N2R8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM43A
Gene Description family with sequence similarity 43, member A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SDMKAELSQLISDLGELSFGNDVRTLQADLRVTRLLSGDSTGSESSIEGGGPDATSATAGDSSRQADGASADEP
Immunogen SDMKAELSQLISDLGELSFGNDVRTLQADLRVTRLLSGDSTGSESSIEGGGPDATSATAGDSSRQADGASADEP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ90022
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N2R8
HTS Code 3002150000
Gene ID 131583
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM43A Antibody 100ul

Anti-FAM43A Antibody 100ul