HSBP1L1,FLJ10967
  • HSBP1L1,FLJ10967

Anti-HSBP1L1 Antibody 25ul

Ref: AN-HPA048273-25ul
Anti-HSBP1L1

Información del producto

Polyclonal Antibody against Human HSBP1L1, Gene description: heat shock factor binding protein 1-like 1, Alternative Gene Names: FLJ10967, MGC189743, Validated applications: ICC, IHC, Uniprot ID: C9JCN9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HSBP1L1
Gene Description heat shock factor binding protein 1-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence NLFQELQEHFQALTATLNLRMEEMGNRIEDLQKNVNDLMVQAGIENSIKEQMLE
Immunogen NLFQELQEHFQALTATLNLRMEEMGNRIEDLQKNVNDLMVQAGIENSIKEQMLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10967, MGC189743
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID C9JCN9
HTS Code 3002150000
Gene ID 440498
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HSBP1L1 Antibody 25ul

Anti-HSBP1L1 Antibody 25ul