PAPD5,TRF4-2
  • PAPD5,TRF4-2

Anti-PAPD5 Antibody 25ul

Ref: AN-HPA048225-25ul
Anti-PAPD5

Información del producto

Polyclonal Antibody against Human PAPD5, Gene description: PAP associated domain containing 5, Alternative Gene Names: TRF4-2, Validated applications: IHC, Uniprot ID: Q8NDF8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PAPD5
Gene Description PAP associated domain containing 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVS
Immunogen YYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TRF4-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NDF8
HTS Code 3002150000
Gene ID 64282
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PAPD5 Antibody 25ul

Anti-PAPD5 Antibody 25ul