CCDC68,SE57-1
  • CCDC68,SE57-1

Anti-CCDC68 Antibody 100ul

Ref: AN-HPA048197-100ul
Anti-CCDC68

Información del producto

Polyclonal Antibody against Human CCDC68, Gene description: coiled-coil domain containing 68, Alternative Gene Names: SE57-1, Validated applications: IHC, WB, Uniprot ID: Q9H2F9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC68
Gene Description coiled-coil domain containing 68
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPS
Immunogen MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHCGNLQQGSDSEMDPS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SE57-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H2F9
HTS Code 3002150000
Gene ID 80323
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCDC68 Antibody 100ul

Anti-CCDC68 Antibody 100ul