ACY3,ACY-3,HCBP1
  • ACY3,ACY-3,HCBP1

Anti-ACY3 Antibody 25ul

Ref: AN-HPA048187-25ul
Anti-ACY3

Información del producto

Polyclonal Antibody against Human ACY3, Gene description: aspartoacylase (aminocyclase) 3, Alternative Gene Names: ACY-3, HCBP1, MGC9740, Validated applications: IHC, WB, Uniprot ID: Q96HD9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ACY3
Gene Description aspartoacylase (aminocyclase) 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MCSLPVPQEPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSR
Immunogen MCSLPVPQEPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ACY-3, HCBP1, MGC9740
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96HD9
HTS Code 3002150000
Gene ID 91703
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ACY3 Antibody 25ul

Anti-ACY3 Antibody 25ul