PFDN6,H2-KE2,HKE2
  • PFDN6,H2-KE2,HKE2

Anti-PFDN6 Antibody 25ul

Ref: AN-HPA048123-25ul
Anti-PFDN6

Información del producto

Polyclonal Antibody against Human PFDN6, Gene description: prefoldin subunit 6, Alternative Gene Names: H2-KE2, HKE2, KE-2, PFD6, Validated applications: ICC, IHC, Uniprot ID: O15212, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PFDN6
Gene Description prefoldin subunit 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAG
Immunogen ARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names H2-KE2, HKE2, KE-2, PFD6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15212
HTS Code 3002150000
Gene ID 10471
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PFDN6 Antibody 25ul

Anti-PFDN6 Antibody 25ul