SDC3,N-syndecan
  • SDC3,N-syndecan

Anti-SDC3 Antibody 25ul

Ref: AN-HPA048085-25ul
Anti-SDC3

Información del producto

Polyclonal Antibody against Human SDC3, Gene description: syndecan 3, Alternative Gene Names: N-syndecan, SYND3, Validated applications: ICC, WB, Uniprot ID: O75056, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SDC3
Gene Description syndecan 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence GDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQPVGTPFEELPSERPTLEPATSPLVVTEVPEEPSQRATTVSTTMATTA
Immunogen GDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQPVGTPFEELPSERPTLEPATSPLVVTEVPEEPSQRATTVSTTMATTA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names N-syndecan, SYND3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75056
HTS Code 3002150000
Gene ID 9672
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SDC3 Antibody 25ul

Anti-SDC3 Antibody 25ul