RAC1,p21-Rac1,Rac-1
  • RAC1,p21-Rac1,Rac-1

Anti-RAC1 Antibody 100ul

Ref: AN-HPA047820-100ul
Anti-RAC1

Información del producto

Polyclonal Antibody against Human RAC1, Gene description: ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1), Alternative Gene Names: p21-Rac1, Rac-1, TC-25, Validated applications: IHC, WB, Uniprot ID: P63000, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAC1
Gene Description ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREI
Immunogen TKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names p21-Rac1, Rac-1, TC-25
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P63000
HTS Code 3002150000
Gene ID 5879
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RAC1 Antibody 100ul

Anti-RAC1 Antibody 100ul