PLPP1,LPP1,PAP-2a
  • PLPP1,LPP1,PAP-2a

Anti-PLPP1 Antibody 25ul

Ref: AN-HPA047815-25ul
Anti-PLPP1

Información del producto

Polyclonal Antibody against Human PLPP1, Gene description: phospholipid phosphatase 1, Alternative Gene Names: LPP1, PAP-2a, PPAP2A, Validated applications: IHC, WB, Uniprot ID: O14494, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PLPP1
Gene Description phospholipid phosphatase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence DFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Immunogen DFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LPP1, PAP-2a, PPAP2A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14494
HTS Code 3002150000
Gene ID 8611
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PLPP1 Antibody 25ul

Anti-PLPP1 Antibody 25ul