LIN37,F25965,lin-37
  • LIN37,F25965,lin-37

Anti-LIN37 Antibody 100ul

Ref: AN-HPA047809-100ul
Anti-LIN37

Información del producto

Polyclonal Antibody against Human LIN37, Gene description: lin-37 DREAM MuvB core complex component, Alternative Gene Names: F25965, lin-37, ZK418.4, Validated applications: ICC, IHC, WB, Uniprot ID: Q96GY3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LIN37
Gene Description lin-37 DREAM MuvB core complex component
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PPGDACRSRIPSPLQPEMQGTPDDEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILREMYERQ
Immunogen PPGDACRSRIPSPLQPEMQGTPDDEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILREMYERQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names F25965, lin-37, ZK418.4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96GY3
HTS Code 3002150000
Gene ID 55957
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LIN37 Antibody 100ul

Anti-LIN37 Antibody 100ul