SMIM4,C3orf78
  • SMIM4,C3orf78

Anti-SMIM4 Antibody 25ul

Ref: AN-HPA047771-25ul
Anti-SMIM4

Información del producto

Polyclonal Antibody against Human SMIM4, Gene description: small integral membrane protein 4, Alternative Gene Names: C3orf78, Validated applications: ICC, IHC, Uniprot ID: Q8WVI0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SMIM4
Gene Description small integral membrane protein 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence IKVRVGQETFYDVYRRKASERQYQRRLEDE
Immunogen IKVRVGQETFYDVYRRKASERQYQRRLEDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C3orf78
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WVI0
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SMIM4 Antibody 25ul

Anti-SMIM4 Antibody 25ul