PCGF2,MEL-18,RNF110
  • PCGF2,MEL-18,RNF110

Anti-PCGF2 Antibody 100ul

Ref: AN-HPA047732-100ul
Anti-PCGF2

Información del producto

Polyclonal Antibody against Human PCGF2, Gene description: polycomb group ring finger 2, Alternative Gene Names: MEL-18, RNF110, ZNF144, Validated applications: IHC, Uniprot ID: P35227, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PCGF2
Gene Description polycomb group ring finger 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCP
Immunogen SLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MEL-18, RNF110, ZNF144
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P35227
HTS Code 3002150000
Gene ID 7703
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PCGF2 Antibody 100ul

Anti-PCGF2 Antibody 100ul