RABEP2,FLJ23282,FRA
  • RABEP2,FLJ23282,FRA

Anti-RABEP2 Antibody 100ul

Ref: AN-HPA047641-100ul
Anti-RABEP2

Información del producto

Polyclonal Antibody against Human RABEP2, Gene description: rabaptin, RAB GTPase binding effector protein 2, Alternative Gene Names: FLJ23282, FRA, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H5N1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RABEP2
Gene Description rabaptin, RAB GTPase binding effector protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LKAKLLRAEELIQEIQRRPRHAPSLHGSTELLPLSRDPSPPLEPLEELSGDGGPAAEAFAHNCDDSASISSFSLGGGVGSSSSLPQSRQGLSPE
Immunogen LKAKLLRAEELIQEIQRRPRHAPSLHGSTELLPLSRDPSPPLEPLEELSGDGGPAAEAFAHNCDDSASISSFSLGGGVGSSSSLPQSRQGLSPE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ23282, FRA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H5N1
HTS Code 3002150000
Gene ID 79874
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RABEP2 Antibody 100ul

Anti-RABEP2 Antibody 100ul