EMC7,C11orf3
  • EMC7,C11orf3

Anti-EMC7 Antibody 100ul

Ref: AN-HPA047572-100ul
Anti-EMC7

Información del producto

Polyclonal Antibody against Human EMC7, Gene description: ER membrane protein complex subunit 7, Alternative Gene Names: C11orf3, C15orf24, Validated applications: ICC, Uniprot ID: Q9NPA0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EMC7
Gene Description ER membrane protein complex subunit 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGW
Immunogen VVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C11orf3, C15orf24
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NPA0
HTS Code 3002150000
Gene ID 56851
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EMC7 Antibody 100ul

Anti-EMC7 Antibody 100ul