XRCC6,D22S671
  • XRCC6,D22S671

Anti-XRCC6 Antibody 100ul

Ref: AN-HPA047549-100ul
Anti-XRCC6

Información del producto

Polyclonal Antibody against Human XRCC6, Gene description: X-ray repair complementing defective repair in Chinese hamster cells 6, Alternative Gene Names: D22S671, D22S731, G22P1, KU70, ML8, Validated applications: ICC, IHC, WB, Uniprot ID: P12956, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name XRCC6
Gene Description X-ray repair complementing defective repair in Chinese hamster cells 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDL
Immunogen PPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D22S671, D22S731, G22P1, KU70, ML8
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P12956
HTS Code 3002150000
Gene ID 2547
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-XRCC6 Antibody 100ul

Anti-XRCC6 Antibody 100ul