PDHA2,PDHAL
  • PDHA2,PDHAL

Anti-PDHA2 Antibody 25ul

Ref: AN-HPA047487-25ul
Anti-PDHA2

Información del producto

Polyclonal Antibody against Human PDHA2, Gene description: pyruvate dehydrogenase (lipoamide) alpha 2, Alternative Gene Names: PDHAL, Validated applications: IHC, Uniprot ID: P29803, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PDHA2
Gene Description pyruvate dehydrogenase (lipoamide) alpha 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVG
Immunogen ILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PDHAL
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P29803
HTS Code 3002150000
Gene ID 5161
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PDHA2 Antibody 25ul

Anti-PDHA2 Antibody 25ul