RRNAD1,C1orf66
  • RRNAD1,C1orf66

Anti-RRNAD1 Antibody 100ul

Ref: AN-HPA047426-100ul
Anti-RRNAD1

Información del producto

Polyclonal Antibody against Human RRNAD1, Gene description: ribosomal RNA adenine dimethylase domain containing 1, Alternative Gene Names: C1orf66, CGI-41, Validated applications: ICC, IHC, Uniprot ID: Q96FB5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RRNAD1
Gene Description ribosomal RNA adenine dimethylase domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LDQELLQALEKEEKRNPQVVQTSPRHSPHHVVRWVDPTALCEELLLPLENPCQGRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG
Immunogen LDQELLQALEKEEKRNPQVVQTSPRHSPHHVVRWVDPTALCEELLLPLENPCQGRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf66, CGI-41
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96FB5
HTS Code 3002150000
Gene ID 51093
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RRNAD1 Antibody 100ul

Anti-RRNAD1 Antibody 100ul