OR11H1,OR22-1
  • OR11H1,OR22-1

Anti-OR11H1 Antibody 100ul

Ref: AN-HPA047370-100ul
Anti-OR11H1

Información del producto

Polyclonal Antibody against Human OR11H1, Gene description: olfactory receptor, family 11, subfamily H, member 1, Alternative Gene Names: OR22-1, Validated applications: IHC, Uniprot ID: Q8NG94, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OR11H1
Gene Description olfactory receptor, family 11, subfamily H, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MCPLTLQVTGLMNVSEPNSSFAFVNEFILQG
Immunogen MCPLTLQVTGLMNVSEPNSSFAFVNEFILQG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names OR22-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NG94
HTS Code 3002150000
Gene ID 81061
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-OR11H1 Antibody 100ul

Anti-OR11H1 Antibody 100ul