PDXDC1,KIAA0251 View larger

Anti-PDXDC1 Antibody 100ul

AN-HPA047369-100ul

New product

Anti-PDXDC1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100ul
Gene Name PDXDC1
Gene Description pyridoxal-dependent decarboxylase domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVSI
Immunogen PTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVSI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0251
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P996
HTS Code 3002150000
Gene ID 23042
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo WB, IHC, ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human PDXDC1, Gene description: pyridoxal-dependent decarboxylase domain containing 1, Alternative Gene Names: KIAA0251, Validated applications: ICC, IHC, WB, Uniprot ID: Q6P996, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image