PSMA7,C6,HSPC,RC6-1
  • PSMA7,C6,HSPC,RC6-1

Anti-PSMA7 Antibody 100ul

Ref: AN-HPA047266-100ul
Anti-PSMA7

Información del producto

Polyclonal Antibody against Human PSMA7, Gene description: proteasome (prosome, macropain) subunit, alpha type, 7, Alternative Gene Names: C6, HSPC, RC6-1, XAPC7, Validated applications: IHC, Uniprot ID: O14818, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PSMA7
Gene Description proteasome (prosome, macropain) subunit, alpha type, 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YITRYIASLKQVGACPLACSPLAAGQSRLRHGGSCHVTSGESE
Immunogen YITRYIASLKQVGACPLACSPLAAGQSRLRHGGSCHVTSGESE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6, HSPC, RC6-1, XAPC7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14818
HTS Code 3002150000
Gene ID 5688
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PSMA7 Antibody 100ul

Anti-PSMA7 Antibody 100ul