MRPL36,BRIP1,L36mt
  • MRPL36,BRIP1,L36mt

Anti-MRPL36 Antibody 25ul

Ref: AN-HPA047238-25ul
Anti-MRPL36

Información del producto

Polyclonal Antibody against Human MRPL36, Gene description: mitochondrial ribosomal protein L36, Alternative Gene Names: BRIP1, L36mt, MRP-L36, PRPL36, RPMJ, Validated applications: ICC, IHC, Uniprot ID: Q9P0J6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPL36
Gene Description mitochondrial ribosomal protein L36
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM
Immunogen PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BRIP1, L36mt, MRP-L36, PRPL36, RPMJ
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P0J6
HTS Code 3002150000
Gene ID 64979
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPL36 Antibody 25ul

Anti-MRPL36 Antibody 25ul