SPC25,AD024
  • SPC25,AD024

Anti-SPC25 Antibody 25ul

Ref: AN-HPA047144-25ul
Anti-SPC25

Información del producto

Polyclonal Antibody against Human SPC25, Gene description: SPC25, NDC80 kinetochore complex component, Alternative Gene Names: AD024, MGC22228, SPBC25, Validated applications: ICC, IHC, WB, Uniprot ID: Q9HBM1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPC25
Gene Description SPC25, NDC80 kinetochore complex component
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence RLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVY
Immunogen RLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AD024, MGC22228, SPBC25
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HBM1
HTS Code 3002150000
Gene ID 57405
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPC25 Antibody 25ul

Anti-SPC25 Antibody 25ul