SMOX,C20orf16
  • SMOX,C20orf16

Anti-SMOX Antibody 25ul

Ref: AN-HPA047117-25ul
Anti-SMOX

Información del producto

Polyclonal Antibody against Human SMOX, Gene description: spermine oxidase, Alternative Gene Names: C20orf16, dJ779E11.1, FLJ20746, MGC1010, PAO, PAOh1, SMO, Validated applications: IHC, Uniprot ID: Q9NWM0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SMOX
Gene Description spermine oxidase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QGFTDVTVLEASSHIGGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGVACYLTNHGRRIPKDVVEEFSDLYN
Immunogen QGFTDVTVLEASSHIGGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGVACYLTNHGRRIPKDVVEEFSDLYN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf16, dJ779E11.1, FLJ20746, MGC1010, PAO, PAOh1, SMO
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NWM0
HTS Code 3002150000
Gene ID 54498
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SMOX Antibody 25ul

Anti-SMOX Antibody 25ul