MRPL20,FLJ10024
  • MRPL20,FLJ10024

Anti-MRPL20 Antibody 100ul

Ref: AN-HPA047074-100ul
Anti-MRPL20

Información del producto

Polyclonal Antibody against Human MRPL20, Gene description: mitochondrial ribosomal protein L20, Alternative Gene Names: FLJ10024, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BYC9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPL20
Gene Description mitochondrial ribosomal protein L20
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence ASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH
Immunogen ASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10024
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BYC9
HTS Code 3002150000
Gene ID 55052
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPL20 Antibody 100ul

Anti-MRPL20 Antibody 100ul