SLC9B2,FLJ23984
  • SLC9B2,FLJ23984

Anti-SLC9B2 Antibody 25ul

Ref: AN-HPA047008-25ul
Anti-SLC9B2

Información del producto

Polyclonal Antibody against Human SLC9B2, Gene description: solute carrier family 9, subfamily B (NHA2, cation proton antiporter 2), member 2, Alternative Gene Names: FLJ23984, NHA2, NHEDC2, Validated applications: IHC, Uniprot ID: Q86UD5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC9B2
Gene Description solute carrier family 9, subfamily B (NHA2, cation proton antiporter 2), member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPTEANHVQR
Immunogen PSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPTEANHVQR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ23984, NHA2, NHEDC2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86UD5
HTS Code 3002150000
Gene ID 133308
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC9B2 Antibody 25ul

Anti-SLC9B2 Antibody 25ul