GTF2H2,BTF2,BTF2P44
  • GTF2H2,BTF2,BTF2P44

Anti-GTF2H2 Antibody 100ul

Ref: AN-HPA047001-100ul
Anti-GTF2H2

Información del producto

Polyclonal Antibody against Human GTF2H2, Gene description: general transcription factor IIH, polypeptide 2, 44kDa, Alternative Gene Names: BTF2, BTF2P44, p44, T-BTF2P44, TFIIH, Validated applications: ICC, WB, Uniprot ID: Q13888, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GTF2H2
Gene Description general transcription factor IIH, polypeptide 2, 44kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence HVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG
Immunogen HVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BTF2, BTF2P44, p44, T-BTF2P44, TFIIH
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13888
HTS Code 3002150000
Gene ID 2966
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GTF2H2 Antibody 100ul

Anti-GTF2H2 Antibody 100ul