CT45A1,CT45-1,CT45.1
  • CT45A1,CT45-1,CT45.1

Anti-CT45A1 Antibody 100ul

Ref: AN-HPA046987-100ul
Anti-CT45A1

Información del producto

Polyclonal Antibody against Human CT45A1, Gene description: cancer/testis antigen family 45, member A1, Alternative Gene Names: CT45-1, CT45.1, Validated applications: ICC, IHC, Uniprot ID: Q5HYN5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CT45A1
Gene Description cancer/testis antigen family 45, member A1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADI
Immunogen PGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT45-1, CT45.1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5HYN5
HTS Code 3002150000
Gene ID 541466
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CT45A1 Antibody 100ul

Anti-CT45A1 Antibody 100ul