SCAF1,FLJ00034,SR-A1
  • SCAF1,FLJ00034,SR-A1

Anti-SCAF1 Antibody 100ul

Ref: AN-HPA046828-100ul
Anti-SCAF1

Información del producto

Polyclonal Antibody against Human SCAF1, Gene description: SR-related CTD-associated factor 1, Alternative Gene Names: FLJ00034, SR-A1, Validated applications: IHC, Uniprot ID: Q9H7N4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SCAF1
Gene Description SR-related CTD-associated factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SRKVKLQSKVAVLIREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKTKVKAKAGAKKTKGTKGKTKPSKT
Immunogen SRKVKLQSKVAVLIREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKTKVKAKAGAKKTKGTKGKTKPSKT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ00034, SR-A1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H7N4
HTS Code 3002150000
Gene ID 58506
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SCAF1 Antibody 100ul

Anti-SCAF1 Antibody 100ul