MRPL19,KIAA0104
  • MRPL19,KIAA0104

Anti-MRPL19 Antibody 25ul

Ref: AN-HPA046805-25ul
Anti-MRPL19

Información del producto

Polyclonal Antibody against Human MRPL19, Gene description: mitochondrial ribosomal protein L19, Alternative Gene Names: KIAA0104, MRP-L15, RLX1, RPML15, Validated applications: ICC, Uniprot ID: P49406, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPL19
Gene Description mitochondrial ribosomal protein L19
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYST
Immunogen LRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYST
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0104, MRP-L15, RLX1, RPML15
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49406
HTS Code 3002150000
Gene ID 9801
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPL19 Antibody 25ul

Anti-MRPL19 Antibody 25ul