KANSL1L,C2orf67
  • KANSL1L,C2orf67

Anti-KANSL1L Antibody 100ul

Ref: AN-HPA046790-100ul
Anti-KANSL1L

Información del producto

Polyclonal Antibody against Human KANSL1L, Gene description: KAT8 regulatory NSL complex subunit 1-like, Alternative Gene Names: C2orf67, FLJ23861, FLJ32349, KIAA1267L, MSL1v2, Validated applications: IHC, WB, Uniprot ID: A0AUZ9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KANSL1L
Gene Description KAT8 regulatory NSL complex subunit 1-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence MLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLNKHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSH
Immunogen MLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLNKHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C2orf67, FLJ23861, FLJ32349, KIAA1267L, MSL1v2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A0AUZ9
HTS Code 3002150000
Gene ID 151050
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KANSL1L Antibody 100ul

Anti-KANSL1L Antibody 100ul