C1orf145,FLJ31994
  • C1orf145,FLJ31994

Anti-C1orf145 Antibody 25ul

Ref: AN-HPA046612-25ul
Anti-C1orf145

Información del producto

Polyclonal Antibody against Human C1orf145, Gene description: chromosome 1 open reading frame 145, Alternative Gene Names: FLJ31994, Validated applications: IHC, Uniprot ID: Q96MR7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C1orf145
Gene Description chromosome 1 open reading frame 145
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MYTASSSAETLRTVRRRSVPSSSMPYLALAHNRVSSLNHAASVDGWGTSHRNVADSFSRTSRSCSRFLKGTAGSARREDWNG
Immunogen MYTASSSAETLRTVRRRSVPSSSMPYLALAHNRVSSLNHAASVDGWGTSHRNVADSFSRTSRSCSRFLKGTAGSARREDWNG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ31994
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96MR7
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C1orf145 Antibody 25ul

Anti-C1orf145 Antibody 25ul