CNOT1,AD-005,CDC39
  • CNOT1,AD-005,CDC39

Anti-CNOT1 Antibody 100ul

Ref: AN-HPA046577-100ul
Anti-CNOT1

Información del producto

Polyclonal Antibody against Human CNOT1, Gene description: CCR4-NOT transcription complex, subunit 1, Alternative Gene Names: AD-005, CDC39, KIAA1007, NOT1, NOT1H, Validated applications: IHC, Uniprot ID: A5YKK6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CNOT1
Gene Description CCR4-NOT transcription complex, subunit 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TIETLMRINAHSRGNAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVG
Immunogen TIETLMRINAHSRGNAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AD-005, CDC39, KIAA1007, NOT1, NOT1H
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A5YKK6
HTS Code 3002150000
Gene ID 23019
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CNOT1 Antibody 100ul

Anti-CNOT1 Antibody 100ul