SNRPA,Mud1,U1-A,U1A
  • SNRPA,Mud1,U1-A,U1A

Anti-SNRPA Antibody 100ul

Ref: AN-HPA046440-100ul
Anti-SNRPA

Información del producto

Polyclonal Antibody against Human SNRPA, Gene description: small nuclear ribonucleoprotein polypeptide A, Alternative Gene Names: Mud1, U1-A, U1A, Validated applications: IHC, WB, Uniprot ID: P09012, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SNRPA
Gene Description small nuclear ribonucleoprotein polypeptide A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP
Immunogen IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Mud1, U1-A, U1A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09012
HTS Code 3002150000
Gene ID 6626
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SNRPA Antibody 100ul

Anti-SNRPA Antibody 100ul