IRS1,HIRS-1
  • IRS1,HIRS-1

Anti-IRS1 Antibody 100ul

Ref: AN-HPA046433-100ul
Anti-IRS1

Información del producto

Polyclonal Antibody against Human IRS1, Gene description: insulin receptor substrate 1, Alternative Gene Names: HIRS-1, Validated applications: ICC, Uniprot ID: P35568, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IRS1
Gene Description insulin receptor substrate 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPL
Immunogen RKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HIRS-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P35568
HTS Code 3002150000
Gene ID 3667
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IRS1 Antibody 100ul

Anti-IRS1 Antibody 100ul