SLX4IP,C20orf94
  • SLX4IP,C20orf94

Anti-SLX4IP Antibody 25ul

Ref: AN-HPA046372-25ul
Anti-SLX4IP

Información del producto

Polyclonal Antibody against Human SLX4IP, Gene description: SLX4 interacting protein, Alternative Gene Names: C20orf94, dJ1099D15.3, Validated applications: ICC, IHC, Uniprot ID: Q5VYV7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLX4IP
Gene Description SLX4 interacting protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MGQAKDSIKAAESHWGLPVQKLEKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESASPCPKQSPRVAKTQQKRRNCSSAEDFDHHGRVSLGSDRLVPR
Immunogen MGQAKDSIKAAESHWGLPVQKLEKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESASPCPKQSPRVAKTQQKRRNCSSAEDFDHHGRVSLGSDRLVPR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf94, dJ1099D15.3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5VYV7
HTS Code 3002150000
Gene ID 128710
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLX4IP Antibody 25ul

Anti-SLX4IP Antibody 25ul