SMPD4,FLJ20297
  • SMPD4,FLJ20297

Anti-SMPD4 Antibody 100ul

Ref: AN-HPA046279-100ul
Anti-SMPD4

Información del producto

Polyclonal Antibody against Human SMPD4, Gene description: sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3), Alternative Gene Names: FLJ20297, FLJ20756, KIAA1418, NET13, nSMase-3, NSMASE3, Validated applications: IHC, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SMPD4
Gene Description sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ASLKADSINKPFAQQCQDLVKVIEDFPAKELHTIFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSIVMEFLDPGGPMMKLVYKLQAEDYKFDFPVSY
Immunogen ASLKADSINKPFAQQCQDLVKVIEDFPAKELHTIFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSIVMEFLDPGGPMMKLVYKLQAEDYKFDFPVSY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20297, FLJ20756, KIAA1418, NET13, nSMase-3, NSMASE3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Gene ID 55627
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SMPD4 Antibody 100ul

Anti-SMPD4 Antibody 100ul