GCHFR,GFRP,HsT16933
  • GCHFR,GFRP,HsT16933

Anti-GCHFR Antibody 100ul

Ref: AN-HPA046258-100ul
Anti-GCHFR

Información del producto

Polyclonal Antibody against Human GCHFR, Gene description: GTP cyclohydrolase I feedback regulator, Alternative Gene Names: GFRP, HsT16933, Validated applications: ICC, IHC, WB, Uniprot ID: P30047, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GCHFR
Gene Description GTP cyclohydrolase I feedback regulator
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Immunogen MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GFRP, HsT16933
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P30047
HTS Code 3002150000
Gene ID 2644
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GCHFR Antibody 100ul

Anti-GCHFR Antibody 100ul