HSPA14,HSP70-4
  • HSPA14,HSP70-4

Anti-HSPA14 Antibody 100ul

Ref: AN-HPA046180-100ul
Anti-HSPA14

Información del producto

Polyclonal Antibody against Human HSPA14, Gene description: heat shock 70kDa protein 14, Alternative Gene Names: HSP70-4, HSP70L1, Validated applications: IHC, WB, Uniprot ID: Q0VDF9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HSPA14
Gene Description heat shock 70kDa protein 14
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence FTVLFPSGTPLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHVTCTDQETGKCEAIS
Immunogen FTVLFPSGTPLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHVTCTDQETGKCEAIS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSP70-4, HSP70L1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q0VDF9
HTS Code 3002150000
Gene ID 51182
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HSPA14 Antibody 100ul

Anti-HSPA14 Antibody 100ul