POM121L2,POM121-L
  • POM121L2,POM121-L

Anti-POM121L2 Antibody 100ul

Ref: AN-HPA046150-100ul
Anti-POM121L2

Información del producto

Polyclonal Antibody against Human POM121L2, Gene description: POM121 transmembrane nucleoporin-like 2, Alternative Gene Names: POM121-L, Validated applications: IHC, Uniprot ID: Q96KW2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name POM121L2
Gene Description POM121 transmembrane nucleoporin-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SHLSASAPPDATSAHLMLKPILGPLHNSEIGSSSYSRISVTAAASSISSLSTIQGTLTPTFKPIFGSIDPLKTTPMIAPFSSKQTPPPFTHAST
Immunogen SHLSASAPPDATSAHLMLKPILGPLHNSEIGSSSYSRISVTAAASSISSLSTIQGTLTPTFKPIFGSIDPLKTTPMIAPFSSKQTPPPFTHAST
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names POM121-L
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96KW2
HTS Code 3002150000
Gene ID 94026
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-POM121L2 Antibody 100ul

Anti-POM121L2 Antibody 100ul