RSF1,HBXAP,p325
  • RSF1,HBXAP,p325

Anti-RSF1 Antibody 100ul

Ref: AN-HPA046129-100ul
Anti-RSF1

Información del producto

Polyclonal Antibody against Human RSF1, Gene description: remodeling and spacing factor 1, Alternative Gene Names: HBXAP, p325, RSF-1, XAP8, Validated applications: ICC, Uniprot ID: Q96T23, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RSF1
Gene Description remodeling and spacing factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQDDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLK
Immunogen KYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQDDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HBXAP, p325, RSF-1, XAP8
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96T23
HTS Code 3002150000
Gene ID 51773
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RSF1 Antibody 100ul

Anti-RSF1 Antibody 100ul