NSUN6,ARL5B-AS1
  • NSUN6,ARL5B-AS1

Anti-NSUN6 Antibody 25ul

Ref: AN-HPA045902-25ul
Anti-NSUN6

Información del producto

Polyclonal Antibody against Human NSUN6, Gene description: NOP2/Sun domain family, member 6, Alternative Gene Names: ARL5B-AS1, FLJ23743, NOPD1, Validated applications: ICC, IHC, WB, Uniprot ID: Q8TEA1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NSUN6
Gene Description NOP2/Sun domain family, member 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence VLLIPVIGPRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQFMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELSRKEIFSG
Immunogen VLLIPVIGPRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQFMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELSRKEIFSG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARL5B-AS1, FLJ23743, NOPD1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TEA1
HTS Code 3002150000
Gene ID 221078
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NSUN6 Antibody 25ul

Anti-NSUN6 Antibody 25ul