CEP170,FAM68A,KAB
  • CEP170,FAM68A,KAB

Anti-CEP170 Antibody 25ul

Ref: AN-HPA045787-25ul
Anti-CEP170

Información del producto

Polyclonal Antibody against Human CEP170, Gene description: centrosomal protein 170kDa, Alternative Gene Names: FAM68A, KAB, KIAA0470, Validated applications: IHC, Uniprot ID: Q5SW79, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CEP170
Gene Description centrosomal protein 170kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SQWASLAANHTRHDQEERIMEFSAPLPLENETEISESGMTVRSTGSATSLASQGERRRRTLPQLPNEEKSLESHRAKVVTQRSEIGEKQDTELQEKETP
Immunogen SQWASLAANHTRHDQEERIMEFSAPLPLENETEISESGMTVRSTGSATSLASQGERRRRTLPQLPNEEKSLESHRAKVVTQRSEIGEKQDTELQEKETP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM68A, KAB, KIAA0470
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5SW79
HTS Code 3002150000
Gene ID 9859
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CEP170 Antibody 25ul

Anti-CEP170 Antibody 25ul