RGPD5,BS-63
  • RGPD5,BS-63

Anti-RGPD5 Antibody 25ul

Ref: AN-HPA045704-25ul
Anti-RGPD5

Información del producto

Polyclonal Antibody against Human RGPD5, Gene description: RANBP2-like and GRIP domain containing 5, Alternative Gene Names: BS-63, DKFZp686I1842, RGP5, Validated applications: IHC, Uniprot ID: Q99666, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RGPD5
Gene Description RANBP2-like and GRIP domain containing 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence APLTEAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS
Immunogen APLTEAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BS-63, DKFZp686I1842, RGP5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99666
HTS Code 3002150000
Gene ID 84220
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RGPD5 Antibody 25ul

Anti-RGPD5 Antibody 25ul