CELA3A,ELA3,ELA3A
  • CELA3A,ELA3,ELA3A

Anti-CELA3A Antibody 100ul

Ref: AN-HPA045650-100ul
Anti-CELA3A

Información del producto

Polyclonal Antibody against Human CELA3A, Gene description: chymotrypsin-like elastase family, member 3A, Alternative Gene Names: ELA3, ELA3A, Validated applications: IHC, Uniprot ID: P09093, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CELA3A
Gene Description chymotrypsin-like elastase family, member 3A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASL
Immunogen LFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ELA3, ELA3A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09093
HTS Code 3002150000
Gene ID 10136
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CELA3A Antibody 100ul

Anti-CELA3A Antibody 100ul